उम्र के हिसाब से ट्राइग्लिसराइड्स स्तर

उम्र के हिसाब से ट्राइग्लिसराइड्स स्तर
उम्र के हिसाब से ट्राइग्लिसराइड्स स्तर

यहबुढ़ापेमेंऊतकोंकीटूटफूटकेकारणहोताहैपरयदिबढ़तीआयुमेंतेजीसेवजनकमहोताहैतोगंभीररोगोंकासंकेतभीहोसकताहै. आइएजानतेहैंइनसभीचीजोंकेबारेमें. यहभीदिलकीमांसपेशीऔररक्तवाहिकाओंपरvasorelaxationलातीहै,रक्तऔरउसकेपोषकतत्वोंकीडिलीवरीअधिकआसानीसेप्राप्तकर. प्रोटीनकीटोडाइटकाएकआवश्यकहिस्साहै. ऐसेकईदिनआतेहैंजबमुझेलगताहैकिमैंफिरसेमोटीहोगईहूंजब्किऐसानहींहै.

6डब्ल्यूटी,केजी)-(4. बसयेध्यानमेंरखेंकिइनबिन्दुओंकानियमितपालनकरेंनकिकभी-कभीकियाऔरफिरछोड़दिया. दोस्तोंवजनयामोटापाकोकमकरनेकायहबहुतहीअच्छाउपायआपसभीलोगोंकेपासहैकिआपलोगअपनेडाइटमेंप्रोटीनयुक्तआहारलेनाशुरूकरदीजिए! कईतरहकीसेहतसेजुड़ीपरेशानियांदूरकरनेकेलिएघरेलूनुस्खे(HomeRemedy)केतौरपरभीएप्पलसाइडरविनेगरयूजकियाजाताहै. येवजनकमकरनेकेसाथमेटाबॉलिज्मऔरपाचनक्रियाकोभीमजबूतबनातेहैं. किंतुशरीरकीआंतरिकस्वच्छताभीउतनी! आपइसयोगासनकोबीच-बीचमेंरूककरभीकरसकतेहैं.

इसकेलिएआपदौड़लगाए,क्योंकिसिर्फदौड़हीएकऐसाउपायहैंजोआपकीचर्बीकोशरीरकोबिनाकोईनुकसानदियाखत्मकरदेतीहैं. उसवक्ततकदिनकीऊंचीगतिविधिस्तरहोनेसेकैलोरीज्यादातेजजलसकतीहै. दूधसेबनीचीजें,मीठाईयोंऔरबासीखादपदार्थोंसेपरहेजकरें जल्दीसोनाऔरउठनाअच्छीलाइफस्टाइलकीनिशानीहै।आयुर्वेदकेअनुसारहमें9-10बजेतकसोजानाचाहियेऔरसुबह4-6केबीचउठजानाचाहिये।HealthlineडॉटकॉमकेअनुसारखराबSleephabitsकेकारणशरीरमेंकईऐसेहार्मोनरीलीसहोतेहैंजोमोटापेकाकारणबनतेहैं।इसलिएअपनेजागनेऔरसोनेकासमयफिक्सरखेंऔरजल्दीसोनेतथाजागनेकीआदतडालें 1. पानीकासेवनदैनिकआहारकाएकबड़ाहिस्साहोनाचाहिए.

उम्र के हिसाब से ट्राइग्लिसराइड्स स्तर मनुष्य के हृदय में कितने वेश्म होते हैं

अपनेभोजनमेंवजनकोकण्ट्रोलकरनेकेलिएमूली,ककड़ी,चना,मटर,बीन्सवपपीताआदिकोशामिलकरे. तोफिरअपनेआशियानेकोपानीकेरिसावयाफिरसीलनसेकैसेबचायाजाए?पिडीलाइटइंडस्ट्रीजलिमिटेडकेग्लोबलसीईओ(कंस्ट्रक्शनकेमिकलडिवीजन)संजयबहादुरकेमुताबिक,वॉटरप्रूफिंगकेजरिएइससमस्यासेनिजातपायाजासकताहैलेकिनआजकीतारीखमेंवॉटरप्रूफिंगकोनिवेशकेरूपमेंदेखाजानाचाहिएनकिलागतकेरूपमें. इसतेजरफ़्तारजीवनमेंहमहरकामजल्दीख़तमकरलेनाचाहतेहैऔरऐसाहीहमभोजनकरतेवक़्तभीकरतेहै।जल्दीजल्दीखानाखाकरपेटभरनेकीबजायआरामसेचबाचबाकरखायेगेतोआपकेपाचनतंत्रकोइसेपचानेमेंअधिकमेहनतनहींकरनीहोगी,शरीरकोपोषणमिलेगाऔरसाथहीइससेआपकोवजनकमहोनेकीप्रक्रियामेंमददमिलेगी पेटकमकरनेकेउपायघरेलूनुस्खेऔरवजनकमकरनेकेलिएक्याखाएंइसकीजानकारीऊपरलेखमेंदीगयीहैआपलेखपढ़े.

पाचनअच्छाहोनेसेमेटाबॉलिज्मभीअच्छाहोताहै. वजनकमकरनेकेलिएसबसेज्यादाचर्चामेंरहनेवालीकीटोडाइटप्लानकोशाकाहारीकैसेअपनाएं?यहसवालअक्सरकईलोगकरतेहैं. आमतौरपरदेखाजाताहैकिकामकीवजहसेबिजीरहनेवालेज्यादातरलोगचायकाइस्तेमालज्यादाकरतेहैं. एप्पलसाइडरविनेगरसुबहसेज्यादारातमेंपीनेसेफायदाकरताहै. रिसर्चसेइसबातकीपुष्टिहुईहैकिफाइबरकाज्यादासेवनऔरशरीरकावजनकमहोनेकेबीचसंबंधहै. आजकलहरकिसीकेहाथमेंमोबाइलऔरइंटरनेटहै।ऐसेमेंपोर्नदेखनाकॉमनबातहै।हालांकिहमारेदेशमेंइसेअच्छानहींमानाजाता।फिरभीलोगइसपरध्याननहींदेतेऔरकईघंटेलोगपोर्नदेखनेमेंबिता. मोटापा.

भारत… कालीचायमेंकैलोरीएकनगण्यराशिकेबराबरहै,प्रतिकपलगभग2कैलोरीचायमेंकैलोरीकीमात्राअन्यउत्पादोंसेप्रभावितहोतीहैजैसेचीनी,शहदयादूध।चीनीकाएकचम्मच15कैलोरीजोड़ताहै,और2प्रतिशतदूधके2चम्मचलगभग12कैलोरीजोड़ताहै।अपनीचायमेंशहदकाआधाऔंसपैकेटजोड़करकैलोरीकासेवन43कैलोरीबढ़ादेताहै अपनेआहारमेंकैलोरीकोकाटनेकेलिएसबसेआसानस्थानोंमेंसेएकआपकेपेयकेमाध्यमसेहैयदिआपपानीकीतुलनामेंथोड़ीअधिकस्वादकेलिएकुछतलाशकररहेहैं,तोचायलगभगनदेनेवालेकैलोरीऔरहृदय-स्वस्थलाभोंकेलिएसबसेअच्छाविकल्पहै अपनीचायकोशहदयाशहदकीतरहकैलोरीमिठाइयांबनानेकेबजाय,अपनीकालीचायमेंस्टेवियाकोजोड़नेकाप्रयासकरें।इसमेंकेवलएकनगण्यकैलोरीहोतीहै,लेकिनइसकाएकप्यालामीठास्वादहोताहै,इसलिएथोड़ासाप्याराकपकेसाथएकलंबारास्तातयकरताहै।इसकेअलावा,नॉनफाटदूधकेलिए2प्रतिशतदूधबाहरगमागमनआपकेकैलोरीसेवनमेंप्रतिकपकुछकैलोरीकमकरदेताहै कालीचायकेमिलासिनेज़िससंयंत्रकाएकमजबूतसंस्करणहैजोहरे,सफेदऔरऊलोंगचायकाउत्पादनकरताहै।कालीचायमेंएकमजबूतस्वादऔरअधिककैफीनकीवजहसेइसकीलंबीऑक्सीकरणहै।यहकिसीभीअधिककैलोरीनहींजोड़ताहै जनऔषधिदिवससप्ताह-पूरेदेशमें7400सेअधिकप्रधानमंत्रीभारतीयजनऔषधिकेंद्रोंकेमाध्यमसेमनायाजारहाहै।जनस्वास्थ्यकेंद्रमालिकस्वास्थ्यऔरस्वच्छताकेबारेमेंजागरूकतापैदाकरनेकेलिएविभिन्नगतिविधियोंकाआयोजनकररहेहैं।1मार्चकोस्वास्थ्यजांचकैंपकीमेजबानीकरकेसमारोहशुरूहुआ,जिसमेंदूसरेदिनब्लडप्रेशरकीजांच,मधुमेहकीजांच,मुफ्तडॉक्टरपरामर्श,मुफ्तदवावितरणआदिकीव्यवस्थाकीगई,जिसमें'जनऔषधिपरिचर्चा'आयोजितकीगईथी।यहचर्चाडॉक्टरों,अस्पतालों,क्लीनिकोंऔरअन्यहितधारकोंकेसहयोगसेबीपीपीआईकेदलने,जनआयुषीमित्रऔरजनआयुषकेंद्रकेमालिकोंद्वाराआयोजितकीगई।जनऔषधिदिवससप्ताहकेतीसरेदिनयानी3मार्च,को,बीपीपीआईकीटीम,जनआयुषीमित्रऔरजनऔषधिकेंद्रमालिकोंनेइसदिनकोदेशभरमें'टीचदेमयंगयानीयुवाओनकोशिक्षादेनेकीतर्जपरमनाया।इसगतिविधिकेदौरान,बीपीपीआईकेअधिकारियोंनेस्कूलों,कॉलेजों,फार्मेसीकॉलेजोंऔरअन्यसंस्थानोंकादौराकियाऔरछात्रोंकेसाथबातचीतकी।चौथेदिन,पीएमबीजेपीनेगतिविधियोंमेंभागलियाऔरमहिलाओंकोसैनिटरीपैडकेउपयोगकेबारेमेंशिक्षितकरनेकेलिएशिविरोंकीमेजबानीकी।इससप्ताहका5वांदिनहमारेवरिष्ठनागरिकोंकोसमर्पित'जनऔषधिकासाथ'केसंदेशकेसाथमनायागया जनऔषधिदिवससप्ताहकाउत्सवकल7मार्च,कोसमाप्तहोगा।प्रधानमंत्रीश्रीनरेंद्रमोदी'जनऔषधिदिवस'समारोहको7मार्च,कोवीडियोकॉन्फ्रेंसकेमाध्यमसेसवेरे10बजेसंबोधितकरेंगे पीएमबीजेपीकेतहतएकदवाकीकीमतशीर्षतीनब्रांडेडदवाओंकेऔसतमूल्यकेअधिकतमसे50प्रतिशतकममूल्यकेसिद्धांतपररखीगईहै।इसलिए,जनऔषधिदवाओंकीकीमतकमसेकम50प्रतिशतऔरकुछमामलोंमेंब्रांडेडदवाओंकेबाजारमूल्यका90प्रतिशततककमहै।चालूवित्तवर्ष-21में,पीएमबीजेपीने5मार्च,तक593.

दोपहरकेखानेएवंरातकेखानेमेंध्यानरखेंकीआपकीथालीकाएकचौथाईहिस्साअनाजसेभराहो,एकचौथाईप्रोटीनवालीचीजोंसेऔरबाकीकेआधेभागमेंसब्जियांभरीहोऔरसाइडमेंएककटोरीदहीहो,ज्यादाभूखलगतीहोतोसलादकीजितनीमात्राचाहेउतनीलेसकतेहै हालांकि,वजनकमकरनेकेकईप्राकृतिकतरीकेहैंजोवास्तवमेंकामकरतेहैंऔरप्रमाणितभीकियेगएहैं।यहांऐसेहीआसानतरीकेबतायेगएहैंजोप्राकृतिकऔरसुरक्षितरूपसेवजनकमकरनेमेंआपकीमददकरेंगे आदिसेबचनेकेलिएअपनेआहारमेंधीरे-धीरेफाइबरशामिलकरें।इनकेलिएभोजनमेंसलाद,साबूतअनाज,अलसीकेबीज,इसबगोल,हरीपत्तेदारसब्जियां,रेशेदारफलआदिचीजेंलें।इसकेअलावादोपहरकेएवंरातकेखानेसेपहलेसलादयाक्लियरसूपलेनेसेभीफाइबरकीमात्राबढ़ानेमददमिलेगी १४.

वजनबढ़ानेवालेकईतरहकेनेचुरलड्रिंक्सलोगोंद्वाराइस्तेमालकिएजातेहैं किशोरावस्थामेंहरकोईअपनीफिटनेसकोलेकरकाफीसजगहोताहै।जिमजानेसेलेकरडाइटपरध्यानदेनेतक,अच्छीफिटनेसके. इसकेसाथहीरोजानानियमितरूपसेव्यायामकरेंऔरहेल्दीडायटफॉलोकरें. देनेकेसाथहीलंबाभीदिखाएगा।कभीभीहॉरिजॉन्टलस्ट्राइप्सनापहनेंइसमेंलड़कियांछोटीऔरमोटीनज़रआतीहैं साड़ीकेपल्लेकोयूंकरेंगीस्टाइलतोकमरदिखेगीपतली गर्मियोंवालेकुर्तेकेलेटेस्टडिज़ाइनदेखिये,इनकेसाथआपकोसलवारपहननेकीजरुरतनहींहै हमेशाडार्ककलर्सकेआउटफिटचुनें हरलड़कीअगरअपनीशॉपिंगकरनेंसेपहलेयेजानलेंऔरइनबातोंकाख्यालरखेतोउसकीशॉपिंगभीजल्दीहोजाएगी।औरउसेबेस्टकपड़ेमिलेंगेजिसमेंवोस्लिमएंडस्टाइलिशदिखेंगी शाहआपकेतीनमुख्यभोजनमेंसेएकचम्मचघीशामिलकरनेकीसलाहदेताहै:नाश्ता,दोपहरकाभोजनऔररातकाखाना.

वितरण का परिभाषा

अभावऊर्जानिष्क्रियताकाकारणबनता,जोबारीमेंअवसादकाकारणबनसकताहै,वजन,मोटापाऔरअधिक. इससेबालोंकाकाफीनुकसानपहुंचताहै. सर्विंग:17ImageCourtesyGettyImages फूलगोभूीविटामिनसीऔरकैल्शियमसेभरपूरहै।जोशरीरमेंरासायनिकतत्वोंकोजज्बकरनेऔरचयापचयप्रणालीकोबढ़ानेमेंसहायकहोतीहै।इसकिस्मकीगोभीमेंमौजूदफाइबरतथापानीकीमात्राउच्चहोतीहैजिसकाअर्थहैकिआपपेटकोलम्बेसमयतकभरा-भरामहसूसकरतेहैंऔरअधिकखानेसेबचतेहैं।हरीफूलगोभीकोसप्ताहमें4बारअपनेभोजनमेंअवश्यशामिलकरें।कुलकैलोरी100ग्रा. छोटीदूरियोंकेलिएगाड़ीलेनेकीआदतकोअलविदाकहें. आपकोपूरारखनेकेलिएपर्याप्तफैट्सकाइस्तेमालआवश्यकहै. इनसबकेबादBreakfastमेंfruitjuiceले.

इससमस्याकोहलकरनेऔरअपनेऑफ़रकीक्वालिटीबेहतरबनानेकेलिए,प्रचारवालाटेक्स्टयाऐसाटेक्स्टविशेषतासेहटादेंजोकामकानहींहै. आपअपनेफेवरेटफूडकेसाथवजनघटासकतेहैं. निम्नलिखितबीमारियोंसेपीड़ितहैंतोऑक्सीमेथोलोनदवाईनालें 25से50मिलीग्रामपूरेदिनमेंएकबारलें 4. कईबारपूराशरीरफैटकेचपेटमेंआजाताहै. एल्कोहलदूसरेतरीकेसेभीआपकावजनबढ़ानेमेंभूमिकानिभाताहै. नीचेपहुंचकरग्लूट्सकोपिछलीस्थितिमेंलातेहुएपिंडलियोंकोभीआरामदेंऔरग्लूट्सकोसख्तीसेएकदूसरेसेजोड़ेरखें।किसीमित्रकीमददसेपरखेंकिआपकीपिंडलियांआरामसेहैंयानहीं?दससेकेंडआरामकेबाद,टॉपपोजिशनमेंबीससेकेंडतकरहें,फिरउसेभीदसबारदोहराएं एकआमगलतफहमीहैकिभागनेसेकूल्हेकीमांसपेशियांस्वत:हीमजबूतहोजातीहैं,परंतुयदिग्लूट्समेंपहलेसेकमजोरीहैतोहैमस्ट्रिंग(घुटनेकीपीछेकीनस),क्वाडरिसैप्स(घुटनेकेऊपरसामनेकीनस)औरपिंडलीकेदर्ददूरकरनेमेंहीसारावक्तनिकलजाताहै।इसलिएयहजरूरीहैसप्ताहमेंएकबारग्लूट्सकाहीव्यायामकियाजाए।ग्लूटब्रिजइसदिशामेंआदर्शव्यायामसाबितहोसकताहै चलते,दौड़ते,सीढ़ियांचढ़तेयाछलांगलगातेसमयआपकेकूल्हेकीमांसपेशियांजिन्हेंग्लूटमसल्सकहतेहैं,मुख्यत:आपकोआगेबढ़ानेऔरशरीरकोसंतुलितकरनेमेंमददकरतीहैं।ग्लूट्समेंकमजोरीआनेसेकुछगंभीरसमस्याएंउपजतीहैंजिनमेंशरीरकाझुकाव,एकाइलेसटेनडिनाइटिस,घुटनेकीतकलीफ,एड़ीऔरपिंडलीकीचोटशामिलहैं।धावकोंकेलिएग्लूट्सकीमजबूतीबेहदजरूरीहोतीहै,क्योंकिइससेउनकेशारीरिककेंद्रक,कूल्हेऔरकमरकोमजबूतीमिलतीहै पानीकीदीवानीहूंऔरखुदसेप्यारहै।प्यारऔरपानीहीजिंदगीकेलिएसबसेज्यादाजरूरीहैं खाने की नली में इन्फेक्शन. लेकिनयहमायनेजरूररखताहैकिआपनियमितरूपसेरनिंगकरें.

आपकोप्रोटीनसेभरपूरनाश्तालेनाहैजोलगभग200कैलारीकेआसपासहोगा ज्यादापानीकेहोतेहैंनुकसान,जानेंएकदिनमेंकितनापानीपीनाचाहिए.


4पाउंड)सेअधिकफैट पानीठंडाहोनेपरयेरिजल्टऔरभीप्रभावशालीहोसकतेहैं।जबआपठंडापानीपीतेहैं,तोआपकेशरीरकेतापमानतकपानीगर्मकरनेकेलिएएक्स्ट्राकैलोरीलगतीहैऔरआपकाफैटभीज्यादाबर्नहोगा मैंबतानाचाहूंगाकिपानीआपकावजनघटासकताहै।बसइसकेलिएआपकोपानीकेबारेमेंपूरीजानकारीहोनाजरूरीहैकिआखिरपानीआपकेवजनऔरफैटघटानेमेंकिसतरहसेमददगारसाबितहोसकताहै तोअबआपसमझहीगएहोंगेकिपानीभीआपकेवेटमैनेजमेंटमेंकितनाअहमरोलरखताहै।इसलिएआपनैचुरलरूपसेपानीइंटेककोबढ़ाएंजिससेआपआसानीसेअपनावजनकमकरसकतेहैंऔरकुछहीसमयमेंफिटहोजाएंगे अबआपसोचरहेहोंगेकिआखिरआपकैसेऔरकितनापानीपिएंकिआपभीवजनकमकरसकें नीचेदीहुईरिसर्चेजमें0.

बिल्व-तैलकानस्यएकमासतकलेनेसेआयुको500सालतकबढ़ाताहै।Thiscombinationextendsageupto500years. खासकरकेवोलोगजोगांवयाछोटेशहरमेंरहतेहैं. कार्डियक कैथीटेराइजेशन. शरीरमेंसोडियमकीमात्राज्यादाहोनेसेकिडनी(Kidney)परअसरपड़ताहै. केअन्यजोखिमकारकओबेजिटा120एमजीकैप्सूल(Obezita120MgCapsule)विटामिनA,E,Dऔरकेजैसेकुछविटामिनोंकेकठिनअवशोषणमेंशामिलहैं।इसीकारणसेचिकित्सकद्वाराखनिजऔरविटामिनकीखुराककीसिफारिशकीजासकतीहै ओबेजिटा120एमजीकैप्सूल(Obezita120MgCapsule)परिधीयअभिनयएंटीबेसिटीएजेंटोंसेसंबंधितहै।यहगैस्ट्रिकऔरअग्नाशयीलिपसकोअवरुद्धकरकेकामकरताहैइसप्रकारट्राइग्लिसराइड्सकेहाइड्रोलिसिसकोअवशोषितमुक्तफैटीएसिडऔरमोनोग्लिसराइड्समेंरोकताहै नीचेदवाइयोंकीसूचीहै,जोसमानसंरचना,ताकतऔरओबेजिटा120एमजीकैप्सूल(Obezita120MgCapsule)केविकल्पकेरूपमेंइस्तेमालकीजासकतीहै इलायचीकासेवनआपकईतरहसेकरसकतेहै।चायमेंडालकरभीइसकासेवनकियाजासकताहै।एकरिसर्चकेमुताबिकअगरइलायचीकेपाउडरकासेवनकरनेंपरपेटकीअतिरिक्तचर्बीकोकमकियाजासकताहै।आपकोबतादेंकिइसकेनियमितसेवनसेशरीरपरकोईबुराअसरनहींपड़ताहै जीहांरिसर्चसेपताचलाहैकिइलायचीकेसेवनसेवजनकमहोताहै।आयुर्वेदमेंभीइसबातकीपुष्टिकीगईहैकिइलायचीकोवजनकमकरनेंकाएकबेहतरमसालाबतायागयाहै।हरीइलायचीशरीरकेचयापचयकोबढ़ाकरआपकेपाचनतंत्रकोसाफ,शरीरकीसूजनकोकमकरनेंऔरकोलेस्टॉलकेस्तरकोकमकरतीहै।जिससेशरीरमेंअतिरिक्तचर्बीकोहटानेंमेंसहायतामिलतीहै।इलायचीमेंसिस्टोलिकऔरडायस्टोलिककोकमकरनेंकेगुणपाएजातेहै।जिससेरक्तसंचारकेस्तरकोप्रभावितकरतेहै इलायचीकोआपअपनीडेलीरुटिनलाइफमेंशामिलकरे।इसेआपकॉफीयाचायमेंडालकरपीसकतेहै।इलायचीकेदानोंकोपीसकरपाउडरबनालेऔरउसेअपनेदूधयाचाययाफिरअपनेंभोजनमेंप्रयोगकरें।इसेअलावाआपखानाखानेंकेबादभीएकइलायचीचबसकतेहै मोटापाबढ़नेंकाएकऔरकारणहैपेटमेंगैसयाशरीरमेंपानीकीकमीकाहोना।जीहांबहुतकमलोगइसबातकेवाकिफनाहोलेकिनमोटापेबढ़नेंकाएककारणयेभीहै।अगरआपकोइसतरहकीसमस्याहैतोआपबिनाकिसीदेरीसेइसकासेवनआजसेहीकरनाशुरुकरदे भारतीयरसोईमेंइलायचीउनमसालोमेंसेएकहैजिसकाइस्तेमालरसोईमेंबनेभोजनकास्वादबढ़ानेंऔरउसकीखूशबूकोदुगुनीकरनेंकेकामआताहै।अपनीतासीर,खूशबूकेकारणयहहरभारतीयरसोईकाहिस्साहोताहै।अपनीसुंगधितखूशबूकेअलावाइलायचीमेंकईऔषधीयगुणपाएजातेहै।इसेमुंहकीदुर्गन्धदूरकरनेंकेलिएभीज्यादासेवनकियाजाताहै।लेकिनबहुतकमलोगयहजानतेहैकि,इलायचीवजनघटानेंमेंभीमददगारसिध्दहोतीहै गर्मपानीपीनेकेफायदेweightlossdrinkinghotwaterbenefitsforhealthhinditipsgarampanikefaydegarampanipinekegarampaninafaydagarampanipinekenuksangarampanikebenefitsgarampaniforweightlossgarampanipinekelabhgarampaniwithhoneyhotwaterbenefitshotwaterbathhotwaterforweightlosshotwaterhoneyandlemonlifecaregharelunuskheghareluupayhomeremediesnaturalremediesbollywoodmoviesnewmovies,सिर्फपानीसेकरे20-30kgवजनकम|WeightLoss,मोटापेसेछुटकारापानीसेकमकरेवजनपानीकीसंतुलितमात्राआपकेवजनकोकमकरेपानीकैसेपियेपानीकबपियेपेटमेंजमाफेटसिर्फपानीसेबाहरनिकालियेweightlossfromwaterlossextrafatfromwaterचर्बीघटायेपानीसेचर्बीयामोटापाकमकरनेकेउपायपुरेशरीरकीचर्बीकमकरेसिर 5.

बजाजकेसाथविचार-विमर्शकरनेकेबादरश्मिकोउनकेबातोंसेहौसलामिला|रश्मिनेअपनेचिंताओंकोएकतरफरखतेहुएgastricbypassसर्जरीकरवानेकानिर्णयलिया| इसकेआलावा,हफ़्तेमें5दिनआधाघंटाभागने,टहलने,भागना,टहलना,याएरोबिक्स,स्विमिंग,औरसाइकिलिंगकरनाआपकेसेहतकेलिएमहत्वपूर्णहै|नियमिततौरपरव्यायामकरनेकीआदतडालनेपरसिर्फवज़नकमहीनहीं,लेकिनहॉर्मोन्ससंतुलनमेंभीरहतेहैं| मोटापाकोlifestylediseaseभीकहाजाताहै|इसकामतलबइसरोगकाइलाजतबहीकियाजासकताहैजबआपअपनेजीवन-शैलीमेंसख़्तशासनबरक़राररखें,रश्मिकोडॉ.

अर्थराइटिसमेंराहत-हल्दीमेंमौजूदएंटी-इंफ्लेमेट्रीप्रोपर्टीजऑस्टियोपरोसिसऔरअर्थराइटिसकेइलाजमेंकारगरहै.

हिंदी में निम्न और उच्च बीपी के लक्षण

  • 900+ Om Namah Shivaya ideas
  • Loosu meaning in Hindi
  • कुत्ते के भोजन में उप
  • Aldo 10 MG Tablet in hindi
  • Folate deficiency meaning in Hindi
  • A calorie is a unit of heat or energy and it equals about 4. ?
  • क्या आपको सांस लेने में
  • फोटो एडिट करने के लिए 7 बेस्ट और फ्री
  • Knowledge of Vata, Pitta, Kapha ET Everything in Telugu Everything in Telugu (ET) this an all in one need in every aspect,
  • Protein hamare sharir ke liye bahut important hein aur #protein ki vajah se hamare sharir me #muscle grow hote hein. आजकल
  • Namaste india news.
  • नमस्कार दोस्तों, हमारे आज के विडियो में हम ये जानेंगे की कैसे आप ये जान सकते हैं की कहीं
  • शाकाहारी। मांसाहारी। सर्वाहारी। Vegetarian । non vegetarian । Omnivores । shakahari । jiv । since #vegetarian
  • Morning Weight Loss Drink | Lose 3 kgs in 5 days | methi water / Jeera Water For Fast Weight Loss morning weight,loss drink

उर्दू में कोलेस्ट्रॉल आहार चार्ट

प्लेटलेट्स वाढवण्यासाठी आवळा लोकप्रिय आयुर्वेदिक उपचार आहे. आवळ्यामध्ये भरपूर दोन चमचे आवळ्याच्या ज्यूसमध्ये मध टाकून तुम्ही हे मिश्रण घेऊ शकता. *पपई* पपईचे फळ आणि 

गर्दन की नस का इलाज

7 Best Foods to Boost your Libido—This Better Sex Smoothie recipe can boost your printable keto Walmart shopping list

शुगर बीपी की आयुर्वेदिक दवा

चेस्ट फैट या छाती की चर्बी आज के समय में भारतीय मर्दो की एक सामान्य समस्या है. दूसरी कई तोंद कम करने के उपाय: पेट की चर्बी(Belly Fat) या तोंद एक परेशानी से ज्यादा कुछ नहीं होता है , पतले दिखने पर भी बढ़े हुए जोखिम में हैं।